MachQ Labs
GLOW

GLOW

$77.99 / €68.01 / £57.72

Pack of 10 vials

Size

Form: Lyophilized Powder

Blend: GHK-Cu 50mg + BPC-157 10mg + TB-500 10mg

GHK-Cu: CAS 89030-95-5 · C14H22CuN6O4 · ≈401.9 g/mol · ≥99% · Gly-His-Lys.Cu.xHAc

BPC-157: CAS 137525-51-0 · C62H98N16O22 · ~1419.5 g/mol · ≥99% · GEPPPGKPADDAGLV

TB-500: CAS 77591-33-4 · C212H350N56O78S · ~4963.4 g/mol · ≥99% · SDKPDMAEIEKFDKSKLKESQAGETSDDEDVVVTDT

Storage & Handling

Storage (Lyophilized): Store at -20°C in a dry, desiccated environment. – After Reconstitution: Store reconstituted peptide at 2–8°C and use within 30 days. For long-term storage, aliquot and freeze at -20°C. Avoid repeated freeze-thaw cycles. – Reconstitution: Reconstitute in sterile bacteriostatic water or appropriate buffer depending on experimental needs.

⚠️ This product is sold strictly for in vitro research and laboratory use only. It is not for human or veterinary use. By purchasing or using this product, the buyer agrees they have read, understood and accept the Terms & Conditions of MachQlabs. Terms & Conditions.

What Customers Say

Quality peptides and great customer service. Shop with them!

E

Elvira Morin

Highly recommend Synedica Retatritide Pharmacy for quality products and services.

J

Jack Butler

Thank you so much for being so personable and the samples. I love the customer service and delivery efficiency.

A

Alexander Morgan

Quality peptides and great customer service. Shop with them!

E

Elvira Morin

Highly recommend Synedica Retatritide Pharmacy for quality products and services.

J

Jack Butler

Thank you so much for being so personable and the samples. I love the customer service and delivery efficiency.

A

Alexander Morgan

0