
Tesamorelin
$61.00 / €53.20 / £45.15
Pack of 10 vialsSize
Form: Lyophilized Powder
CAS Number: 901758-09-6
Molecular Formula: C223H370N72O69S
Molecular Weight: ~5135.9 g/mol
Purity: ≥99%
Peptide Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Storage & Handling
Storage (Lyophilized): Store at -20°C in a dry, desiccated environment. – After Reconstitution: Store reconstituted peptide at 2–8°C and use within 30 days. For long-term storage, aliquot and freeze at -20°C. Avoid repeated freeze-thaw cycles. – Reconstitution: Reconstitute in sterile bacteriostatic water or appropriate buffer depending on experimental needs.
⚠️ This product is sold strictly for in vitro research and laboratory use only. It is not for human or veterinary use. By purchasing or using this product, the buyer agrees they have read, understood and accept the Terms & Conditions of MachQlabs. Terms & Conditions.
What Customers Say
“Quality peptides and great customer service. Shop with them!”
Elvira Morin
“Highly recommend Synedica Retatritide Pharmacy for quality products and services.”
Jack Butler
“Thank you so much for being so personable and the samples. I love the customer service and delivery efficiency.”
Alexander Morgan
“Quality peptides and great customer service. Shop with them!”
Elvira Morin
“Highly recommend Synedica Retatritide Pharmacy for quality products and services.”
Jack Butler
“Thank you so much for being so personable and the samples. I love the customer service and delivery efficiency.”
Alexander Morgan